نجوم تي في لمشاهدة احدث الافلام والمسلسلات الاجنبية والعربية اون لاين

4.78 Rating by CuteStat

nogoumtv.com is 4 years 1 month old. It is a domain having com extension. It has a global traffic rank of #3860243 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, nogoumtv.com is SAFE to browse.

PageSpeed Score
91
Siteadvisor Rating
No Risk Issues

Traffic Report

Daily Unique Visitors: 218
Daily Pageviews: 436

Estimated Valuation

Income Per Day: $ 1.00
Estimated Worth: $ 240.00

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: No Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 3,860,243
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.27.183.223

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
نجوم تي في - مشاهدة احدث الافلام والمسلسلات اون لاين

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 2 H2 Headings: 2
H3 Headings: 31 H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 30
Google Adsense: Not Applicable Google Analytics: UA-108706858-1

Websites Hosted on Same IP (i.e. 104.27.183.223)

Site Maintenance

- flowerwallstickers.xyz
Not Applicable $ 8.95

liqisuwa.top

- liqisuwa.top

liqisuwa.top

Not Applicable $ 8.95

Welcome

- chadars345entitled.top
Not Applicable $ 8.95

Phlebotomyhandbook: Terri Windling is a famous author whose books you

- phlebotomyhandbook.info

Free pdf ebooks download and best deals search. Top300 rating and book reviews

Not Applicable $ 8.95

arena777

- arena777.net

arena777

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Wed, 01 Apr 2020 05:15:03 GMT
Content-Type: text/html; charset=UTF-8
Transfer-Encoding: chunked
Connection: keep-alive
Vary: Accept-Encoding
Link: <https://www.nogoumtv.com/wp-json/>; rel="https://api.w.org/"
Cache-Control: max-age=0
Expires: Wed, 01 Apr 2020 05:15:03 GMT
X-Cache: HIT from Backend
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 57cfd4819dfbed2f-SJC
Content-Encoding: gzip

Domain Nameserver Information

Host IP Address Country
arch.ns.cloudflare.com 108.162.193.68 United States of America United States of America
cora.ns.cloudflare.com 162.159.38.195 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
nogoumtv.com A 299 IP: 104.27.182.223
nogoumtv.com A 299 IP: 104.27.183.223
nogoumtv.com NS 86400 Target: arch.ns.cloudflare.com
nogoumtv.com NS 86400 Target: cora.ns.cloudflare.com
nogoumtv.com SOA 3600 MNAME: arch.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2033670043
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
nogoumtv.com AAAA 300 IPV6: 2606:4700:3031::681b:b6df
nogoumtv.com AAAA 300 IPV6: 2606:4700:3031::681b:b7df

Similarly Ranked Websites

Business and IT Consulting Services for Small Businesses

- daemon.co.in

Daemon software delivers value through our Business and IT consulting Services that help clients improve performance & reduce costs by harnessing the power of the digital economy.

3,860,244 $ 240.00

ATS - Leading Electrical Solutions Provider in Cambodia | Home

- ats.com.kh

ATS is a specialist of energy and electrical distribution and automation systems. We supply, design and manufacture solutions meeting specific clients and projects thanks to our manufacturing facility and our multi-technologies / multi-brands approach.

3,860,249 $ 240.00

ClickFunnels™ - Marketing Funnels Made Easy

- physique-zero.com

ClickFunnels Gives You EVERYTHING You Need To Market, Sell, and Deliver Your Products and Services Online! Without having to hire or rely on a tech team!

3,860,251 $ 240.00

ELEKTRİKLİ BİSİKLETLER BEYİNLER AKÜLER TANITIMLAR ELEKTRİKLİ BİSİKLET

- elektriklibisiklet.org

elektrikli bisiklet şarj,elektrikli bisiklet,elektrikli bisiklet beyin,elektrikli bisiklet modifiye,led far,power led far,elektrikli bisiklet aküsü,elektrikli scoter,elektrikli bisiklet gaz kolu,elektrikli bisiklet aküsü,12 volt 20 amper akü,jel akü,

3,860,256 $ 240.00

404 Not Found

- watchintenselyswiftthefile.vip
3,860,262 $ 240.00

Full WHOIS Lookup

Domain Name: NOGOUMTV.COM
Registry Domain ID: 2506766164_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: http://www.dynadot.com
Updated Date: 2020-03-24T07:09:03.0Z
Creation Date: 2020-03-24T07:04:17.0Z
Registrar Registration Expiration Date: 2021-03-24T07:04:17.0Z
Registrar: DYNADOT LLC
Registrar IANA ID: 472
Registrar Abuse Contact Email: abuse@dynadot.com
Registrar Abuse Contact Phone: +1.6502620100
Domain Status: clientTransferProhibited
Registry Registrant ID:
Registrant Name: Super Privacy Service LTD c/o Dynadot
Registrant Street: PO Box 701
Registrant Street:
Registrant City: San Mateo
Registrant State/Province: California
Registrant Postal Code: 94401
Registrant Country: US
Registrant Phone: +1.6505854708
Registrant Email: nogoumtv.com@superprivacyservice.com
Registry Admin ID:
Admin Name: Super Privacy Service LTD c/o Dynadot
Admin Street: PO Box 701
Admin Street:
Admin City: San Mateo
Admin State/Province: California
Admin Postal Code: 94401
Admin Country: US
Admin Phone: +1.6505854708
Admin Email: nogoumtv.com@superprivacyservice.com
Registry Tech ID:
Tech Name: Super Privacy Service LTD c/o Dynadot
Tech Street: PO Box 701
Tech Street:
Tech City: San Mateo
Tech State/Province: California
Tech Postal Code: 94401
Tech Country: US
Tech Phone: +1.6505854708
Tech Email: nogoumtv.com@superprivacyservice.com
Name Server: arch.ns.cloudflare.com
Name Server: cora.ns.cloudflare.com
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-03-31 22:12:01 -0700 <<<